Anti-PAPPA (Pappalysin-1, Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease, IGF-d

PAPP A (PAPP-A, Insulin-like growth factor binding protein-4 protease, PAPP-A-proMBP complex) was originally isolated from pregnancy serum as heterotetrameric protein complex with molecular weight approximately 500kD, consisting of two PAPP A subunits disulfide-linked with two subunits of the proform of eosinophil major basic protein (proMBP). In such a complex proMBP functions as an inhibitor of PAPP A proteinase activity. PAPP A is widely used as a marker of some pathologies during pregnancy. Low maternal serum levels of PAPP-A in first trimester biochemical screening is used as a marker of Down's syndrome (Trisomy 21). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.