Anti-OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19

Anti-OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19
Item number Size Datasheet Manual SDS Delivery time Quantity Price
249595.100 100 µg - -

3 - 19 business days*

699.00€
 
This gene encodes a basic helix-loop-helix transcription factor which is expressed in... more
Product information "Anti-OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19"
This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14,21)(q11.2,q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. [provided by RefSeq, Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 249595

Properties

Application: ELISA, IP, WB
Antibody Type: Monoclonal
Clone: 2A8
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: OLIG2 (NP_005797, 2aa-78aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19"
Write a review
or to review a product.
Viewed