Anti-NUSAP1 (Nucleolar and Spindle-associated Protein 1, NuSAP, ANKT, BM-037, PRO0310, BM037, FLJ134

Anti-NUSAP1 (Nucleolar and Spindle-associated Protein 1, NuSAP, ANKT, BM-037, PRO0310, BM037, FLJ134
Item number Size Datasheet Manual SDS Delivery time Quantity Price
130660.50 50 µg - -

3 - 19 business days*

699.00€
 
Microtubule-associated protein with the capacity to bundle and stabilize microtubules By... more
Product information "Anti-NUSAP1 (Nucleolar and Spindle-associated Protein 1, NuSAP, ANKT, BM-037, PRO0310, BM037, FLJ134"
Microtubule-associated protein with the capacity to bundle and stabilize microtubules By similarity. May associate with chromosomes and promote the organization of mitotic spindle microtubules around them. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQERKEKKAKVLGMRRGLILAED, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 130660

Properties

Application: IF, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NUSAP1 (Nucleolar and Spindle-associated Protein 1, NuSAP, ANKT, BM-037, PRO0310, BM037, FLJ134"
Write a review
or to review a product.
Viewed