Anti-NOXO1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41407.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Constitutively potentiates the superoxide-generating activity of NOX1 and NOX3... more

Close menu

Product information "Anti-NOXO1"

Protein function: Constitutively potentiates the superoxide-generating activity of NOX1 and NOX3 and is required for the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity. Isoform 3 is more potent than isoform 1 in activating NOX3. Together with NOXA1, may also substitute to NCF1/p47phox and NCF2/p67phox in supporting the phagocyte NOX2/gp91phox superoxide-generating activity. [The UniProt Consortium]

Keywords:	Anti-NOXO1, Anti-P41NOX, Anti-Nox organizer 1, Anti-Nox-organizing protein 1, Anti-NADPH oxidase organizer 1, Anti-NADPH oxidase regulatory protein, Anti-SH3 and PX domain-containing protein 5
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41407

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: cow, horse)
Immunogen:	Synthetic peptide derived from Human NOXO1. (within the following region: HSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDR)
MW:	40 kD
Format:	Affinity Purified