Anti-NOX4 / NADPH oxidase 4

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4166 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NADPH oxidase 4 is an enzyme that in... more
Product information "Anti-NOX4 / NADPH oxidase 4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NADPH oxidase 4 is an enzyme that in humans is encoded by the NOX4 gene, and is a member of the NOX family of NADPH oxidases. This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants. Protein function: NADPH oxidase that catalyzes predominantly the reduction of oxygen to H2O2 (PubMed:15356101, PubMed:14966267, PubMed:15927447, PubMed:25062272, PubMed:21343298). Can also catalyze to a smaller extent, the reduction of oxygen to superoxide (PubMed:10869423, PubMed:11032835, PubMed:15155719, PubMed:15572675, PubMed:16230378, PubMed:16179589, PubMed:16324151, PubMed:15927447, PubMed:16019190, PubMed:25062272). May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity (PubMed:16019190). May regulate insulin signaling cascade (PubMed:14966267). May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB (PubMed:15572675, PubMed:15356101). May produce superoxide in the nucleus and play a role in regulating gene expression upon cell stimulation (PubMed:16324151). [The UniProt Consortium]
Keywords: Anti-NOX4, Anti-RENOX, Anti-KOX-1, Anti-NADPH oxidase 4, Anti-Kidney oxidase-1, Anti-Renal NAD(P)H-oxidase, Anti-Kidney superoxide-producing NADPH oxidase, NOX4 Antibody / NADPH oxidase 4
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4166

Properties

Application: IF, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, monkey
Immunogen: Amino acids ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NOX4 / NADPH oxidase 4"
Write a review
or to review a product.
Viewed