Anti-NLRP1 / NALP1

Anti-NLRP1 / NALP1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40189.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: As the sensor component of the NLRP1 inflammasome, plays a crucial role in... more
Product information "Anti-NLRP1 / NALP1"
Protein function: As the sensor component of the NLRP1 inflammasome, plays a crucial role in innate immunity and inflammation. In response to pathogens and other damage-associated signals, initiates the formation of the inflammasome polymeric complex, made of NLRP1, CASP1, and possibly PYCARD. Recruitment of proCASP1 to the inflammasome promotes its activation and CASP1-catalyzed IL1B and IL18 maturation and secretion in the extracellular milieu. Activation of NLRP1 inflammasome is also required for HMGB1 secretion. The active cytokines and HMGB1 stimulate inflammatory responses. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death (PubMed:22665479, PubMed:17418785). May be activated by muramyl dipeptide (MDP), a fragment of bacterial peptidoglycan, in a NOD2-dependent manner (PubMed:18511561). Contrary to its mouse ortholog, not activated by Bacillus anthracis lethal toxin (PubMed:19651869). It is unclear whether isoform 2 is involved in inflammasome formation. It is not cleaved within the FIIND domain, does not assemble into specks, nor promote IL1B release (PubMed:22665479). However, in an vitro cell-free system, it has been shown to be activated by MDP (PubMed:17349957). Binds ATP (PubMed:11113115, PubMed:15212762). [The UniProt Consortium]
Keywords: Anti-NLRP1, Anti-Caspase recruitment domain-containing protein 7, Anti-NACHT, LRR and PYD domains-containing protein 1, Anti-Nucleotide-binding domain and caspase recruitment domain, Anti-Death effector filament-forming ced-4-like apoptosis protein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40189

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, guinea pig, horse, swine, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human NLRP1 / NALP1. (Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL)
MW: 166 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NLRP1 / NALP1"
Write a review
or to review a product.
Viewed