Anti-NFIB / NF1B2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59017.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Transcriptional activator of GFAP, essential for proper brain development... more

Close menu

Product information "Anti-NFIB / NF1B2"

Protein function: Transcriptional activator of GFAP, essential for proper brain development (PubMed:30388402). Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [The UniProt Consortium]

Keywords:	Anti-CTF, Anti-NFIB, Anti-NFI-B, Anti-NF1-B, Anti-NF-I/B, Anti-Nuclear factor 1/B, Anti-Nuclear factor I/B, Anti-TGGCA-binding protein, Anti-Nuclear factor 1 B-type, Anti-CCAAT-box-binding transcription factor
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59017

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence of Human NFIB / NF1B2 (ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR)
MW:	47 kD
Format:	Antigen Affinity Purified