Anti-Myoglobin (N-Terminal Region)

Anti-Myoglobin (N-Terminal Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32952 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myoglobin (MB) also known as PVALB, is a... more
Product information "Anti-Myoglobin (N-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myoglobin (MB) also known as PVALB, is a single-chain globular protein of 153 or 154 amino acids, containing a heme (iron-containing porphyrin) prosthetic group in the center around which the remaining apoprotein folds. It is a member of the globin superfamily and is expressed in skeletal and cardiac muscles. This gene is mapped to chromosome 22q11-q13. Myoglobin is released from damaged muscle tissue (rhabdomyolysis), which has very high concentrations of myoglobin. The released myoglobin is filtered by the kidneys but is toxic to the renal tubular epithelium and so may cause acute renal failure. Protein function: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. [The UniProt Consortium]
Keywords: Anti-MB, Anti-Myoglobin, Myoglobin Antibody (N-Terminal Region)
Supplier: NSJ Bioreagents
Supplier-Nr: R32952

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 3-35 (LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFK) were used as the immunogen for the Myoglobin antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Myoglobin (N-Terminal Region)"
Write a review
or to review a product.
Viewed