Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R32952 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myoglobin (MB) also known as PVALB, is a... more
Product information "Anti-Myoglobin (N-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myoglobin (MB) also known as PVALB, is a single-chain globular protein of 153 or 154 amino acids, containing a heme (iron-containing porphyrin) prosthetic group in the center around which the remaining apoprotein folds. It is a member of the globin superfamily and is expressed in skeletal and cardiac muscles. This gene is mapped to chromosome 22q11-q13. Myoglobin is released from damaged muscle tissue (rhabdomyolysis), which has very high concentrations of myoglobin. The released myoglobin is filtered by the kidneys but is toxic to the renal tubular epithelium and so may cause acute renal failure. Protein function: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. [The UniProt Consortium]
Keywords: | Anti-MB, Anti-Myoglobin, Myoglobin Antibody (N-Terminal Region) |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R32952 |
Properties
Application: | WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human |
Immunogen: | Amino acids 3-35 (LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFK) were used as the immunogen for the Myoglobin antibody. |
Format: | Purified |
Database Information
KEGG ID : | K21892 | Matching products |
UniProt ID : | P02144 | Matching products |
Gene ID | GeneID 4151 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed