Anti-MSI1 / Musashi 1, clone 2B9

Anti-MSI1 / Musashi 1, clone 2B9
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ5670 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. RNA-binding protein Musashi homolog 1 is a... more
Product information "Anti-MSI1 / Musashi 1, clone 2B9"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13. Protein function: RNA binding protein that regulates the expression of target mRNAs at the translation level. Regulates expression of the NOTCH1 antagonist NUMB. Binds RNA containing the sequence 5'-GUUAGUUAGUUAGUU- 3' and other sequences containing the pattern 5'-[GA]U(1-3)AGU-3'. May play a role in the proliferation and maintenance of stem cells in the central nervous system. [The UniProt Consortium]
Keywords: Anti-MSI1, Anti-Musashi-1, Anti-RNA-binding protein Musashi homolog 1, MSI1 Antibody / Musashi 1
Supplier: NSJ Bioreagents
Supplier-Nr: RQ5670

Properties

Application: WB, IHC (paraffin), IF
Antibody Type: Monoclonal
Clone: 2B9
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: Amino acids KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MSI1 / Musashi 1, clone 2B9"
Write a review
or to review a product.
Viewed