Anti-MOG / Myelin Oligodendrocyte Glycoprotein

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4651 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myelin oligodendrocyte glycoprotein (MOG)... more
Product information "Anti-MOG / Myelin Oligodendrocyte Glycoprotein"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS). In humans this protein is encoded by the MOG gene. This gene is mapped to 6p22.1. It is speculated to serve as a necessary adhesion molecule to provide structural integrity to the myelin sheath and is known to develop late on the oligodendrocyte. The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. Protein function: Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell- cell communication. [The UniProt Consortium]
Keywords: Anti-MOG, Anti-Myelin-oligodendrocyte glycoprotein, MOG Antibody / Myelin Oligodendrocyte Glycoprotein
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4651

Properties

Application: WB, IHC (paraffin), FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MOG / Myelin Oligodendrocyte Glycoprotein"
Write a review
or to review a product.
Viewed