Anti-MOG / Myelin oligodendrocyte glycoprotein

Anti-MOG / Myelin oligodendrocyte glycoprotein

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41772.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath.... more

Close menu

Product information "Anti-MOG / Myelin oligodendrocyte glycoprotein"

Protein function: Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell- cell communication. [The UniProt Consortium]

Keywords:	Anti-MOG, Anti-Myelin-oligodendrocyte glycoprotein
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41772

Properties

Application:	FC, IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence of Human MOG / Myelin oligodendrocyte glycoprotein. (RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK)
MW:	28 kD
Format:	Antigen Affinity Purified