Anti-MMP11

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41556.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: May play an important role in the progression of epithelial malignancies. [The... more

Close menu

Product information "Anti-MMP11"

Protein function: May play an important role in the progression of epithelial malignancies. [The UniProt Consortium]

Keywords:	Anti-ST3, Anti-SL-3, Anti-STMY3, Anti-MMP11, Anti-MMP-11, EC=3.4.24.-, Anti-Stromelysin-3, Anti-Matrix metalloproteinase-11
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41556

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat
Immunogen:	Synthetic peptide corresponding to aa. 104-135 of Human MMP11. (RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK)
MW:	54 kD
Format:	Antigen Affinity Purified