Anti-MMP10

Anti-MMP10
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31922 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Stromelysin-2 also known as matrix... more
Product information "Anti-MMP10"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Stromelysin-2 also known as matrix metalloproteinase-10 or Transin-2 is an enzyme that in humans is encoded by the MMP10 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans and fibronectin. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. Protein function: Can degrade fibronectin, gelatins of type I, III, IV, and V, weakly collagens III, IV, and V. Activates procollagenase. [The UniProt Consortium]
Keywords: Anti-SL-2, Anti-MMP10, Anti-STMY2, Anti-MMP-10, Anti-Transin-2, EC=3.4.24.22, Anti-Stromelysin-2, Anti-Matrix metalloproteinase-10, MMP10 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31922

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids RFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAF of human MMP10 were used as the immunogen for the MMP10 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MMP10"
Write a review
or to review a product.
Viewed