Anti-MBD1

Anti-MBD1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ5826 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. MBD1 (Methyl-CpG-Binding Domain Protein... more
Product information "Anti-MBD1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. MBD1 (Methyl-CpG-Binding Domain Protein 1), also known as PCM1 or CXXC3, is a protein that in humans is encoded by the MBD1 gene. Using PCR on a hybrid panel and FISH, Hendrich et al.(1999) mapped the MBD1 gene to chromosome 18q21, 2.1 cM distal to MBD2. Using yeast 2-hybrid analysis, reciprocal immunoprecipitation analysis, and protein pull-down assays, Fujita et al.(2003) showed that MBD1 interacted directly with MCAF. Deletion analysis revealed that the C-terminal transcriptional repressor domain(TRD) of MBD1 interacted with a conserved C-terminal domain of MCAF. Reporter gene assays showed that MCAF increased the repressive function of the isolated TRD of MBD1 against SP1. Chromatin immunoprecipitation analysis revealed that MBD1 linked MCAF to methylated promoters. Uchimura et al.(2006) found that MBD1 was multiply sumoylated in HeLa cells. Sumoylation did not alter the intracellular localization of MBD1 at nuclear foci in C-33A human cervical cancer cells. Protein function: Transcriptional repressor that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. Binding is abolished by the presence of 7-mG that is produced by DNA damage by methylmethanesulfonate (MMS). Acts as transcriptional repressor and plays a role in gene silencing by recruiting AFT7IP, which in turn recruits factors such as the histone methyltransferase SETDB1. Probably forms a complex with SETDB1 and ATF7IP that represses transcription and couples DNA methylation and histone 'Lys-9' trimethylation. Isoform 1 and isoform 2 can also repress transcription from unmethylated promoters. [The UniProt Consortium]
Keywords: Anti-CXXC3, Anti-Methyl-CpG-binding protein MBD1, Anti-CXXC-type zinc finger protein 3, Anti-Methyl-CpG-binding domain protein 1, Anti-Protein containing methyl-CpG-binding domain 1, MBD1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ5826

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids DLTLFDFKQGILCYPAPKAHPVAVASKKRK from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MBD1"
Write a review
or to review a product.
Viewed