Anti-Matriptase (ST14, Suppressor Of Tumorigenicity 14 Protein, Membrane-type Serine Protease 1, Ser

Matriptase or MT-SP1 is an epithelial-derived type II transmembrane serine protease that is highly expressd in human cancer-derived cell lines. Matriptase cleaves and activates protease activated receptor-2, pro-urokinase plasminogen activator and pro-hepatocyte growth factor. Matriptase is strongly inhibited by the hepatocyte growth factor activator inhibitor type 1 (HAI-1), which is a reactive site loop of Kunitz domain and also a transmembrane serine protease inhibitor. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKD*, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.