Anti-JAK1

Anti-JAK1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32701 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. JAK1 (Janus Kinase 1) is a human tyrosine... more
Product information "Anti-JAK1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. JAK1 (Janus Kinase 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-a/b) and type II (IFN-g) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families. Loss of Jak1 is lethal in neonatal mice, possibly due to difficulties suckling. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body. Protein function: Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway (PubMed:7615558, PubMed:28111307, PubMed:32750333, PubMed:16239216). Kinase partner for the interleukin (IL)-2 receptor (PubMed:11909529) as well as interleukin (IL)-10 receptor (PubMed:12133952). Directly phosphorylates STAT but also activates STAT signaling through the transactivation of other JAK kinases associated with signaling receptors (PubMed:16239216, PubMed:32750333). [The UniProt Consortium]
Keywords: Anti-JAK1, Anti-JAK1A, Anti-JAK-1, Anti-Janus kinase 1, Anti-Tyrosine-protein kinase JAK1, JAK1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32701

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 78-115 (FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-JAK1"
Write a review
or to review a product.
Viewed