Anti-ILF2 / NF45

Anti-ILF2 / NF45
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40964.50 50 µl - -

6 - 14 business days*

520.00€
 
Protein function: Appears to function predominantly as a heterodimeric complex with ILF3. This... more
Product information "Anti-ILF2 / NF45"
Protein function: Appears to function predominantly as a heterodimeric complex with ILF3. This complex may regulate transcription of the IL2 gene during T-cell activation. It can also promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA. Essential for the efficient reshuttling of ILF3 (isoform 1 and isoform 2) into the nucleus. [The UniProt Consortium]
Keywords: Anti-ILF2, Anti-NF45, Anti-PRO3063, Anti-Interleukin enhancer-binding factor 2, Anti-Nuclear factor of activated T-cells 45 kDa
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40964

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: human, mouse, rat, cow, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Human ILF2. (within the following region: FPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIV)
MW: 43 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ILF2 / NF45"
Write a review
or to review a product.
Viewed