Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R32108 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. IGFBP1, Insulin-like growth factor-binding... more
Product information "Anti-IGFBP1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Protein function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration. [The UniProt Consortium]
Keywords: | Anti-IBP-1, Anti-Igfbp1, Anti-Igfbp-1, Anti-IGFBP-1, Anti-IGF-binding protein 1, Anti-Insulin-like growth factor-binding protein 1, IGFBP1 Antibody |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R32108 |
Properties
Application: | WB, ELISA |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | mouse, rat |
Immunogen: | Amino acids REIADLKKWKEPCQRELYKVLERLAAAQQKA of mouse IGFBP1 were used as the immunogen for the IGFBP1antibody. |
Format: | Purified |
Database Information
KEGG ID : | K23578 | Matching products |
UniProt ID : | P47876 | Matching products |
Gene ID | GeneID 16006 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed