Anti-IGFBP1

Anti-IGFBP1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG10676.50 50 µg - -

6 - 14 business days*

559.00€
 
Protein function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to... more
Product information "Anti-IGFBP1"
Protein function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration. [The UniProt Consortium]
Keywords: Anti-IBP-1, Anti-Igfbp1, Anti-Igfbp-1, Anti-IGFBP-1, Anti-IGF-binding protein 1, Anti-Insulin-like growth factor-binding protein 1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG10676

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Synthetic peptide corresponding to the sequence at a.a 177-207 (REIADLKKWKEPCQRELYKVLERLAAAQQKA) around the C-terminus of mouse IGFBP1 protein
MW: 28 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IGFBP1"
Write a review
or to review a product.
Viewed