Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
128228.100 | 100 µg | - | - |
3 - 19 business days* |
744.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Treatment of breast carcinoma MCF7 cells with estradiol led to induction of a new 27kD protein,... more
Product information "Anti-IFI27 (Interferon alpha-inducible Protein 27, Mitochondrial, p27, Interferon alpha-induced 11.5"
Treatment of breast carcinoma MCF7 cells with estradiol led to induction of a new 27kD protein, the cDNA was later cloned and identified as p27. This highly hydrophobic protein of 122aa has 33% overall sequence similarity to the product of the 6-16 gene, that is induced by alfa/beta type interferons. It has been shown that p27 is transcriptionally induced by interferon-alpha in various human cell lines. The induction induced by interferon alpha is independent of the presence of estradiol receptors on the cells. High levels of p27 mRNA, detected by Northern blotting, was found in 50% of the primary breast carcinoma cells, suggesting p27 can be a diagnostic marker for breast carcinoma detection. Examination of p27 expression by in situ hybridization in p27 over-expressing tumors suggest that p27 gene is localized in cancer cells and sometimes also in fibroblastic cells of tumor stroma. IFI27 mRNA expression is highly up-regulated in lesional psoriatic epidermis and in non-lesional keratinocytes. It was also expressed in lichen planus, chronic eczema, cutaneous squamous cell cancers, and during normal wound repair IFI27 was found in the proliferating subpopulation of keratinocytes. Further studies are now necessary to elucidate the cause of p27 gene overexpression in breast carcinoma and in particular to determine whether it corresponds to chromosomal rearrangements in the 14q32 region and/or to induction by interferons of the alpha/beta type. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: | United States Biological |
Supplier-Nr: | 128228 |
Properties
Application: | WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human |
Format: | Affinity Purified |
Database Information
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed