Anti-ICA1 / ICA69

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58943.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: May play a role in neurotransmitter secretion. [The UniProt Consortium] more

Close menu

Product information "Anti-ICA1 / ICA69"

Protein function: May play a role in neurotransmitter secretion. [The UniProt Consortium]

Keywords:	Anti-p69, Anti-ICA1, Anti-ICA69, Anti-ICAp69, Anti-Islet cell autoantigen 1, Anti-Islet cell autoantigen p69, Anti-69 kDa islet cell autoantigen
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58943

Properties

Application:	IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen:	Synthetic peptide around the N-terminal region of Human ICA1 / ICA69. (within the following region: SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS)
Format:	Affinity Purified