Anti-HuD / ELAVL4

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R32036	100 µg		-	-	3 - 10 business days*		755.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. HuD, otherwise known as ELAV-like protein... more

Close menu

Product information "Anti-HuD / ELAVL4"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. HuD, otherwise known as ELAV-like protein 4 or PNEM, is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is anRNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds toAU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity. Protein function: May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR. Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA. [The UniProt Consortium]

Keywords:	Anti-HuD, Anti-HUD, Anti-ELAVL4, Anti-Hu-antigen D, Anti-ELAV-like protein 4, Anti-Paraneoplastic encephalomyelitis antigen HuD, HuD Antibody / ELAVL4
Supplier:	NSJ Bioreagents
Supplier-Nr:	R32036

Properties

Application:	WB, IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Amino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody.
Format:	Purified