Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R32036 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HuD, otherwise known as ELAV-like protein... more
Product information "Anti-HuD / ELAVL4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HuD, otherwise known as ELAV-like protein 4 or PNEM, is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is anRNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds toAU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity. Protein function: May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR. Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA. [The UniProt Consortium]
Keywords: | Anti-HuD, Anti-HUD, Anti-ELAVL4, Anti-Hu-antigen D, Anti-ELAV-like protein 4, Anti-Paraneoplastic encephalomyelitis antigen HuD, HuD Antibody / ELAVL4 |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R32036 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
Immunogen: | Amino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody. |
Format: | Purified |
Database Information
KEGG ID : | K13208 | Matching products |
UniProt ID : | P26378 | Matching products |
Gene ID | GeneID 1996 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed