Anti-HOXB1 (C-Terminal Region)

Anti-HOXB1 (C-Terminal Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32961 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Homeobox protein Hox-B1 is a protein that... more
Product information "Anti-HOXB1 (C-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. Protein function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. [The UniProt Consortium]
Keywords: Anti-HOX2I, Anti-HOXB1, Anti-Homeobox protein Hox-B1, Anti-Homeobox protein Hox-2I, HOXB1 Antibody (C-Terminal Region)
Supplier: NSJ Bioreagents
Supplier-Nr: R32961

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 176-220 (TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK) were used as the immunogen for the HOXB1 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HOXB1 (C-Terminal Region)"
Write a review
or to review a product.
Viewed