Anti-HOXB1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58801.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Sequence-specific transcription factor which is part of a developmental... more

Close menu

Product information "Anti-HOXB1"

Protein function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. [The UniProt Consortium]

Keywords:	Anti-HOX2I, Anti-HOXB1, Anti-Homeobox protein Hox-2I, Anti-Homeobox protein Hox-B1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58801

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 176-220 of Human HOXB1 (TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK)
MW:	32 kD
Format:	Antigen Affinity Purified