Anti-HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058)

Anti-HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
128002.100 100 µg - -

3 - 19 business days*

699.00€
 
Probably serves as a target for the spiC protein from Salmonella typhimurium, which inactivates... more
Product information "Anti-HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058)"
Probably serves as a target for the spiC protein from Salmonella typhimurium, which inactivates it, leading to a strong alteration in cellular trafficking. Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). May regulate clearance of endocytosed receptors such as MSR1. Participates in defining the architecture and localization of the Golgi complex. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: QNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATAR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 128002

Properties

Application: ELISA, IHC, WB
Antibody Type: Monoclonal
Clone: 3A5
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058)"
Write a review
or to review a product.
Viewed