Anti-GRK6

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58831.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Specifically phosphorylates the activated forms of G protein-coupled receptors.... more

Close menu

Product information "Anti-GRK6"

Protein function: Specifically phosphorylates the activated forms of G protein-coupled receptors. Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their desensitization. Seems to be involved in the desensitization of D2-like dopamine receptors in striatum and chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor: LRP6 during Wnt signaling (in vitro). [The UniProt Consortium]

Keywords:	Anti-GRK6, Anti-GPRK6, EC=2.7.11.16, Anti-G protein-coupled receptor kinase 6, Anti-G protein-coupled receptor kinase GRK6
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58831

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat (Expected: bovine)
Immunogen:	Synthetic peptide corresponding to aa. 382-417 of Human GRK6 (QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR)
MW:	66 kD
Format:	Antigen Affinity Purified