Anti-GRK5

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58830.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Serine/threonine kinase that phosphorylates preferentially the activated forms... more
Product information "Anti-GRK5"
Protein function: Serine/threonine kinase that phosphorylates preferentially the activated forms of a variety of G-protein- coupled receptors (GPCRs). Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their down-regulation. Phosphorylates a variety of GPCRs, including adrenergic receptors, muscarinic acetylcholine receptors (more specifically Gi-coupled M2/M4 subtypes), dopamine receptors and opioid receptors. In addition to GPCRs, also phosphorylates various substrates: Hsc70- interacting protein/ST13, TP53/p53, HDAC5, and arrestin-1/ARRB1. Phosphorylation of ARRB1 by GRK5 inhibits G-protein independent MAPK1/MAPK3 signaling downstream of 5HT4-receptors. Phosphorylation of HDAC5, a repressor of myocyte enhancer factor 2 (MEF2) leading to nuclear export of HDAC5 and allowing MEF2- mediated transcription. Phosphorylation of TP53/p53, a crucial tumor suppressor, inhibits TP53/p53-mediated apoptosis. Phosphorylation of ST13 regulates internalization of the chemokine receptor. Phosphorylates rhodopsin (RHO) (in vitro) and a non G- protein-coupled receptor, LRP6 during Wnt signaling (in vitro). [The UniProt Consortium]
Keywords: Anti-GRK5, Anti-GPRK5, EC=2.7.11.16, Anti-G protein-coupled receptor kinase 5, Anti-G protein-coupled receptor kinase GRK5
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58830

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat (Expected: chicken)
Immunogen: Synthetic peptide corresponding to aa. 393-429 of Human GRK5 (KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK)
MW: 68 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GRK5"
Write a review
or to review a product.
Viewed