Anti-GPM6A

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59645.50 50 µl - -

6 - 14 business days*

520.00€
 
Protein function: Involved in neuronal differentiation, including differentiation and migration... more
Product information "Anti-GPM6A"
Protein function: Involved in neuronal differentiation, including differentiation and migration of neuronal stem cells. Plays a role in neuronal plasticity and is involved in neurite and filopodia outgrowth, filopodia motility and probably synapse formation. GPM6A-induced filopodia formation involves mitogen-activated protein kinase (MAPK) and Src signaling pathways. May be involved in neuronal NGF-dependent Ca(2+) influx. May be involved in regulation of endocytosis and intracellular trafficking of G- protein-coupled receptors (GPCRs), enhances internalization and recycling of mu-type opioid receptor. [The UniProt Consortium]
Keywords: Anti-M6a, Anti-M6A, Anti-GPM6A, Anti-Neuronal membrane glycoprotein M6-a
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59645

Properties

Application: ICC, IF, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat (Expected: mouse, bovine, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the C-terminal region of Human GPM6A. (within the following region: IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN)
MW: 31 kD
Format: Affinity Purified

Database Information

UniProt ID : P51674 | Matching products
Gene ID GeneID 2823 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GPM6A"
Write a review
or to review a product.
Viewed