Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-RQ4426 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fos-related antigen 1 (FRA1) is a protein... more
Product information "Anti-FRA1 / Fos-related antigen 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fos-related antigen 1 (FRA1) is a protein that in humans is encoded by the FOSL1 gene. The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.
Keywords: | Anti-FRA1, Anti-FOSL1, Anti-FRA-1, Anti-Fos-related antigen 1, FRA1 Antibody / Fos-related antigen 1 |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | RQ4426 |
Properties
Application: | WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human |
Immunogen: | Amino acids QPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPH from the human protein were used as the immunogen for the FRA1 antibody. |
Format: | Purified |
Database Information
KEGG ID : | K04502 | Matching products |
UniProt ID : | P15407 | Matching products |
Gene ID | GeneID 8061 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed