Anti-FRA1 / Fos-related antigen 1

Anti-FRA1 / Fos-related antigen 1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4426 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fos-related antigen 1 (FRA1) is a protein... more
Product information "Anti-FRA1 / Fos-related antigen 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fos-related antigen 1 (FRA1) is a protein that in humans is encoded by the FOSL1 gene. The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.
Keywords: Anti-FRA1, Anti-FOSL1, Anti-FRA-1, Anti-Fos-related antigen 1, FRA1 Antibody / Fos-related antigen 1
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4426

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids QPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPH from the human protein were used as the immunogen for the FRA1 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FRA1 / Fos-related antigen 1"
Write a review
or to review a product.
Viewed