| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| ARG58710.50 | 50 µg | - | - |
6 - 14 business days* |
520.00€
|
| Keywords: | Anti-FMO1, Anti-FMO 1, EC=1.14.13.8, Anti-Dimethylaniline oxidase 1, Anti-Fetal hepatic flavin-containing monooxygenase 1, Anti-Dimethylaniline monooxygenase [N-oxide-forming] 1 |
| Supplier: | Arigo Biolaboratories |
| Supplier-Nr: | ARG58710 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
| Immunogen: | Synthetic peptide corresponding to aa. 334-363 of Human FMO1 (AFPFLDESVVKVEDGQASLYKYIFPAHLQK) |
| MW: | 60 kD |
| Format: | Antigen Affinity Purified |
Database Information
| KEGG ID : | K00485 | Matching products |
| UniProt ID : | Q01740 | Matching products |
| Gene ID | GeneID 2326 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
