Anti-Fibromodulin

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58756.50 50 µl - -

6 - 14 business days*

520.00€
 
Protein function: Affects the rate of fibrils formation. May have a primary role in collagen... more
Product information "Anti-Fibromodulin"
Protein function: Affects the rate of fibrils formation. May have a primary role in collagen fibrillogenesis. [The UniProt Consortium]
Keywords: Anti-FM, Anti-FMOD, Anti-Fibromodulin, Anti-KSPG fibromodulin, Anti-Collagen-binding 59 kDa protein, Anti-Keratan sulfate proteoglycan fibromodulin
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58756

Properties

Application: ICC, IF, IHC (frozen), IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, horse (Expected: mouse, rat, bovine, dog, guinea pig, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human Fibromodulin. (within the following sequence: VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER)
MW: 43 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Fibromodulin"
Write a review
or to review a product.
Viewed