Anti-FGF9

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41395.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Plays an important role in the regulation of embryonic development, cell... more

Close menu

Product information "Anti-FGF9"

Protein function: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. [The UniProt Consortium]

Keywords:	Anti-GAF, Anti-FGF9, Anti-FGF-9, Anti-HBGF-9, Anti-Glia-activating factor, Anti-Fibroblast growth factor 9, Anti-Heparin-binding growth factor 9
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41395

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence of Human FGF9 (DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY)
MW:	23 kD
Format:	Antigen Affinity Purified