Anti-FGB / Fibrinogen beta chain

Anti-FGB / Fibrinogen beta chain
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58574.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Cleaved by the protease thrombin to yield monomers which, together with... more
Product information "Anti-FGB / Fibrinogen beta chain"
Protein function: Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways. [The UniProt Consortium]
Keywords: Anti-FGB
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58574

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 193-225 of Human FGB / Fibrinogen beta chain. (TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT)
MW: 56 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FGB / Fibrinogen beta chain"
Write a review
or to review a product.
Viewed