Anti-FABP1 (Fatty Acid Binding Protein 1, liver, FABPL, L-FABP)

Anti-FABP1 (Fatty Acid Binding Protein 1, liver, FABPL, L-FABP)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
245902.100 100 µg - -

3 - 19 business days*

699.00€
 
FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a... more
Product information "Anti-FABP1 (Fatty Acid Binding Protein 1, liver, FABPL, L-FABP)"
FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 245902

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 50000000
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: FABP1 (AAH32801, 1aa-127aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FABP1 (Fatty Acid Binding Protein 1, liver, FABPL, L-FABP)"
Write a review
or to review a product.
Viewed