Anti-EPHA6 (Ephrin Type-A Receptor 6, EPH Homology Kinase 2, EHK-2, Ehk-2, Ehk2)

Anti-EPHA6 (Ephrin Type-A Receptor 6, EPH Homology Kinase 2, EHK-2, Ehk-2, Ehk2)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
126383.100 100 µg - -

3 - 19 business days*

699.00€
 
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the... more
Product information "Anti-EPHA6 (Ephrin Type-A Receptor 6, EPH Homology Kinase 2, EHK-2, Ehk-2, Ehk2)"
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The tyrosine kinase (TK) group is mainly involved in the regulation of cell-cell interactions such as differentiation, adhesion, motility and death. There are currently about 90 TK genes sequenced, 58 are of receptor protein TK (e.g. EGFR, EPH, FGFR, PDGFR, TRK, and VEGFR families), and 32 of cytosolic TK (e.g. ABL, FAK, JAK, and SRC families). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody., Optimal dilutions to be determined by the researcher. Amino Acid Sequence: PSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDGKFHCCSLKTDP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 126383

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 2H2
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant protein corresponding to aa613-712 from human EPHA6 (NP_001249) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-EPHA6 (Ephrin Type-A Receptor 6, EPH Homology Kinase 2, EHK-2, Ehk-2, Ehk2)"
Write a review
or to review a product.
Viewed