Anti-EpCAM

Anti-EpCAM
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32527 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Epithelial cell adhesion molecule (EpCAM)... more
Product information "Anti-EpCAM"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cellûcell adhesion in epithelia. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. Protein function: May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E. [The UniProt Consortium]
Keywords: Anti-KSA, Anti-EGP, Anti-CD326, Anti-EPCAM, Anti-Ep-CAM, Anti-EGP314, Anti-hEGP314, Anti-GA733-2, Anti-KS 1/4 antigen, Anti-Epithelial glycoprotein, Anti-Epithelial glycoprotein 314, Anti-Epithelial cell surface antigen, EpCAM Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32527

Properties

Application: WB, IHC (paraffin), ELISA (protein)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 147-189 (ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-EpCAM"
Write a review
or to review a product.
Viewed