Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-RQ4564 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ELAV-like protein 2 is a protein that in... more
Product information "Anti-ELAVL2 / ELAV-like protein 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ELAV-like protein 2 is a protein that in humans is encoded by the ELAVL2 gene. This gene encodes a member of the cytochrome P450 superfamily of enzymes, and is commonly known as sterol 27-hydroxylase. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. Protein function: Binds RNA. Seems to recognize a GAAA motif. Can bind to its own 3'-UTR, the FOS 3'-UTR and the ID 3'-UTR. [The UniProt Consortium]
Keywords: | Anti-HUB, Anti-HuB, Anti-ELAVL2, Anti-Hu-antigen B, Anti-ELAV-like protein 2, Anti-ELAV-like neuronal protein 1, Anti-Nervous system-specific RNA-binding protein Hel-N1, ELAVL2 Antibody / ELAV-like protein 2 |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | RQ4564 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, mouse |
Immunogen: | Amino acids METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK |
Format: | Purified |
Database Information
KEGG ID : | K13208 | Matching products |
UniProt ID : | Q12926 | Matching products |
Gene ID | GeneID 1993 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed