Anti-ELAVL2 / ELAV-like protein 2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4564 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ELAV-like protein 2 is a protein that in... more
Product information "Anti-ELAVL2 / ELAV-like protein 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ELAV-like protein 2 is a protein that in humans is encoded by the ELAVL2 gene. This gene encodes a member of the cytochrome P450 superfamily of enzymes, and is commonly known as sterol 27-hydroxylase. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. Protein function: Binds RNA. Seems to recognize a GAAA motif. Can bind to its own 3'-UTR, the FOS 3'-UTR and the ID 3'-UTR. [The UniProt Consortium]
Keywords: Anti-HUB, Anti-HuB, Anti-ELAVL2, Anti-Hu-antigen B, Anti-ELAV-like protein 2, Anti-ELAV-like neuronal protein 1, Anti-Nervous system-specific RNA-binding protein Hel-N1, ELAVL2 Antibody / ELAV-like protein 2
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4564

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ELAVL2 / ELAV-like protein 2"
Write a review
or to review a product.
Viewed