Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
ABE-36-1581-100 | 100 µg | - |
3 - 11 business days* |
853.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit... more
Product information "Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(Clone: DOG-1.1)"
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%. Protein function: Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development. [The UniProt Consortium]
Keywords: | Anti-ANO1, Anti-DOG1, Anti-Anoctamin-1, Anti-Transmembrane protein 16A, Anti-Oral cancer overexpressed protein 2, Anti-Tumor-amplified and overexpressed sequence 2, Anti-Discovered on gastrointestinal stromal tumors protein 1, Monoclonal Antibody to DOG-1 |
Supplier: | Abeomics |
Supplier-Nr: | 36-1581 |
Properties
Application: | FC, IF, IHC |
Antibody Type: | Monoclonal |
Clone: | DOG-1.1 |
Conjugate: | No |
Host: | Mouse |
Species reactivity: | human |
Immunogen: | A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjµgated to a carrier protein. |
Format: | Affinity Purified |
Database Information
KEGG ID : | K19496 | Matching products |
UniProt ID : | Q5XXA6 | Matching products |
Gene ID | GeneID 55107 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed