Anti-DHX15 / Prp43

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG42699.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Pre-mRNA processing factor involved in disassembly of spliceosomes after the... more

Close menu

Product information "Anti-DHX15 / Prp43"

Protein function: Pre-mRNA processing factor involved in disassembly of spliceosomes after the release of mature mRNA. In cooperation with TFIP11 seem to be involved in the transition of the U2, U5 and U6 snRNP-containing IL complex to the snRNP-free IS complex leading to efficient debranching and turnover of excised introns. [The UniProt Consortium]

Keywords:	Anti-DBP1, Anti-DHX15, Anti-DEAH box protein 15, Anti-ATP-dependent RNA helicase #46, Anti-Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG42699

Properties

Application:	FC, IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence of Human DHX15 / Prp43. (DIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY)
MW:	91 kD
Format:	Antigen Affinity Purified