Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
125831-HRP.100 | 100 µl | - | - |
3 - 19 business days* |
927.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone... more
Product information "Anti-DHRS9 (Dehydrogenase/Reductase SDR Family Member 9, 3-alpha Hydroxysteroid Dehydrogenase, NADP-"
3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH. Applications: Suitable for use in ELISA and Western Blot. OOther applications have not been tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV, Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap., , Note: Applications are based on unconjugated antibody.
Keywords: | Anti-RDHL, Anti-RDH15, Anti-DHRS9, Anti-RDH-E2, Anti-RDH-TBE, EC=1.1.-.-, Anti-3-alpha-HSD, Anti-Retinol dehydrogenase 15, Anti-3-alpha hydroxysteroid dehydrogenase, Anti-Short-chain dehydrogenase/reductase retSDR8 |
Supplier: | United States Biological |
Supplier-Nr: | 125831-HRP |
Properties
Application: | ELISA, ICC, WB |
Antibody Type: | Monoclonal |
Clone: | 3C6 |
Conjugate: | HRP |
Host: | Mouse |
Species reactivity: | human |
Format: | Affinity Purified |
Database Information
KEGG ID : | K11149 | Matching products |
UniProt ID : | Q9BPW9 | Matching products |
Gene ID | GeneID 10170 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed