Anti-DHRS9 (Dehydrogenase/Reductase SDR Family Member 9, 3-alpha Hydroxysteroid Dehydrogenase, NADP-

Anti-DHRS9 (Dehydrogenase/Reductase SDR Family Member 9, 3-alpha Hydroxysteroid Dehydrogenase, NADP-
Item number Size Datasheet Manual SDS Delivery time Quantity Price
125831-APC.100 100 µl - -

3 - 19 business days*

927.00€
 
3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone... more
Product information "Anti-DHRS9 (Dehydrogenase/Reductase SDR Family Member 9, 3-alpha Hydroxysteroid Dehydrogenase, NADP-"
3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH. Applications: Suitable for use in FLISA, Immunocytochemistry/Immunofluorescence and Western Blot. Other applications have not been tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV, Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap., , Note: Applications are based on unconjugated antibody.
Keywords: Anti-RDHL, Anti-RDH15, Anti-DHRS9, Anti-RDH-E2, Anti-RDH-TBE, EC=1.1.-.-, Anti-3-alpha-HSD, Anti-Retinol dehydrogenase 15, Anti-3-alpha hydroxysteroid dehydrogenase, Anti-Short-chain dehydrogenase/reductase retSDR8
Supplier: United States Biological
Supplier-Nr: 125831-APC

Properties

Application: ELISA, ICC, IF, WB
Antibody Type: Monoclonal
Clone: 3C6
Conjugate: APC
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-DHRS9 (Dehydrogenase/Reductase SDR Family Member 9, 3-alpha Hydroxysteroid Dehydrogenase, NADP-"
Write a review
or to review a product.
Viewed