Anti-DHRS9

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41272.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: 3-alpha-hydroxysteroid dehydrogenase that converts 3-... more

Close menu

Product information "Anti-DHRS9"

Protein function: 3-alpha-hydroxysteroid dehydrogenase that converts 3- alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone (PubMed:11294878, PubMed:29541409). Plays also a role in the biosynthesis of retinoic acid from retinaldehyde (PubMed:11304534, PubMed:12618084). Can utilize both NADH and NADPH. [The UniProt Consortium]

Keywords:	Anti-RDHL, Anti-DHRS9, Anti-RDH15, Anti-RDH-E2, Anti-RDH-TBE, Anti-3-alpha-HSD, Anti-Retinol dehydrogenase 15, Anti-3-alpha hydroxysteroid dehydrogenase, Anti-Dehydrogenase/reductase SDR family member 9, Anti-Short-chain dehydrogenase/reductase retSDR8
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41272

Properties

Application:	IP, WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: human, mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen:	Synthetic peptide around the middle region of Human DHRS9. (within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV)
MW:	35 kD
Format:	Affinity Purified