Anti-CHTOP / Chromatin target of PRMT1 protein / C1orf77

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ7159 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes a small nuclear protein... more
Product information "Anti-CHTOP / Chromatin target of PRMT1 protein / C1orf77"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Protein function: Plays an important role in the ligand-dependent activation of estrogen receptor target genes (PubMed:19858291). May play a role in the silencing of fetal globin genes (PubMed:20688955). Recruits the 5FMC complex to ZNF148, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes. Plays an important role in the tumorigenicity of glioblastoma cells. Binds to 5-hydroxymethylcytosine (5hmC) and associates with the methylosome complex containing PRMT1, PRMT5, MEP50 and ERH. The CHTOP- methylosome complex associated with 5hmC is recruited to selective sites on the chromosome, where it methylates H4R3 and activates the transcription of genes involved in glioblastomagenesis (PubMed:25284789). [The UniProt Consortium]
Keywords: Anti-SRAG, Anti-HT031, Anti-CHTOP, Anti-C1orf77, Anti-Friend of PRMT1 protein, Anti-Chromatin target of PRMT1 protein, Anti-Small arginine- and glycine-rich protein, CHTOP Antibody / Chromatin target of PRMT1 protein / C1orf77
Supplier: NSJ Bioreagents
Supplier-Nr: RQ7159

Properties

Application: WB, IHC (paraffin), FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat, monkey
Immunogen: Amino acids AAQSAPKVVLKSTTKMSLNERFTNMLKNKQ
Format: Purified

Database Information

UniProt ID : Q9Y3Y2 | Matching products
Gene ID GeneID 26097 | Matching products

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CHTOP / Chromatin target of PRMT1 protein / C1orf77"
Write a review
or to review a product.
Viewed