Anti-CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4)

Anti-CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
244490.100 100 µg - -

3 - 19 business days*

699.00€
 
This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane... more
Product information "Anti-CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4)"
This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Expression of this particular cadherin in osteoblastic cell lines, and its upregulation during differentiation, suggests a specific function in bone development and maintenance. [provided by RefSeq, Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GWVWNQFFVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQVTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKDMGGHMGGLSGTTKVMITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIGENGLVTYNIVDGDGMESFEITTDYETQEGVIKLKKPVDFETKRAYSLKVEAANVHIDPKFISNGPFKDTVTVKIAVEDADEPPMFLAPSYIHEVQENMouse monoclonal antibody raised against a partial recombinant CDH11.GTVVGRVHAKDPDAANSPIRYSIDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVPVAIRVLDVNDNAPKFAAPYEGFICESDQTKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 244490

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 300
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: CDH11 (P55287, 54aa-612aa) partial recombinant protein with GST tag.
Format: Purified

Database Information

KEGG ID : K06803 | Matching products
UniProt ID : P55287 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4)"
Write a review
or to review a product.
Viewed