Anti-CDC20

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG42680.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Required for full ubiquitin ligase activity of the anaphase promoting... more

Close menu

Product information "Anti-CDC20"

Protein function: Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation. [The UniProt Consortium]

Keywords:	Anti-CDC20, Anti-p55CDC, Anti-Cell division cycle protein 20 homolog
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG42680

Properties

Application:	FC, ICC, IF, IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence of Human CDC20. (QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT)
MW:	55 kD
Format:	Antigen Affinity Purified