Anti-CCDC6 | Arigo Biolaboratories | Biomol.com

To be able to use Biomol GmbH - Life Science Shop in full range, we recommend activating Javascript in your browser.

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59212.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Product information "Anti-CCDC6"

Keywords:	Anti-CCDC6, Anti-D10S170, Anti-Protein H4, Anti-Coiled-coil domain-containing protein 6, Anti-Papillary thyroid carcinoma-encoded protein
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59212

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat (Expected: bovine, chicken, dog, hamster, horse, monkey, rabbit, zebrafish)
Immunogen:	Synthetic peptide corresponding to aa. 156-198 of Human CCDC6. (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE)
MW:	53 kD
Format:	Antigen Affinity Purified

Database Information

KEGG ID :	K09288 \| Matching products
UniProt ID :	Q16204 \| Matching products
Gene ID	GeneID 8030 \| Matching products

Handling & Safety

Storage:	-20°C
Shipping:	+4°C (International: °C)

Caution
Our products are for laboratory research use only: Not for administration to humans!

Information about the product reference will follow. more

View product citations for antibody ARG59212 on CiteAb

You will get a certificate here

Log in or register to request a certificate of analysis.

Read, write and discuss reviews... more

Customer review for "Anti-CCDC6"

Write a review

Log in or register to review a product.

Viewed