Anti-Cathepsin E

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58551.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: May have a role in immune function. Probably involved in the processing of... more

Close menu

Product information "Anti-Cathepsin E"

Protein function: May have a role in immune function. Probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation. May play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degeneration and glial cell activation in the brain. [The UniProt Consortium]

Keywords:	Anti-CTSE, EC=3.4.23.34
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58551

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: horse)
Immunogen:	Synthetic peptide of Human Cathepsin E. (within the following sequence: SLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFG)
MW:	40 kD
Format:	Affinity Purified