Anti-CA4 / Carbonic Anhydrase 4

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58375.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate... more

Close menu

Product information "Anti-CA4 / Carbonic Anhydrase 4"

Protein function: Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid. [The UniProt Consortium]

Keywords:	Anti-CA4, Anti-CA-IV, EC=4.2.1.1, Anti-Carbonic anhydrase 4, Anti-Carbonic anhydrase IV, Anti-Carbonate dehydratase IV
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58375

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, guinea pig, horse, rabbit)
Immunogen:	Synthetic peptide around the C-terminal region of Human CA4. (within the following sequence: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG)
MW:	34 kD
Format:	Affinity Purified